DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and si:ch211-203d1.3

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_021328548.1 Gene:si:ch211-203d1.3 / 101886694 ZFINID:ZDB-GENE-160113-15 Length:607 Species:Danio rerio


Alignment Length:327 Identity:71/327 - (21%)
Similarity:126/327 - (38%) Gaps:60/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH-YLCVMASDTPDQNLSQYFSVC 70
            ::|..||:|:..::.:..:|::..:.:|:.:........|:.. |:.:...|....:|..:::..
Zfish   302 RILDYLYLGSEWNAANFEELQKNNVGYILNVTMEIDNFFPECFTYMNIRVYDVEATDLLSHWNNT 366

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            ..||:.||.....||:||..|:|||.:..:|::|........:||..||..|.:..||.||..||
Zfish   367 YMFINEARKSGQAVLVHCKMGVSRSASTVIAFLMKQQGWTLDQALNHVRERRPIVQPNEGFLKQL 431

  Fly   136 QEFEQFKLSEERRR---LRERFPSSALEQLDRTKVATALDN-----YQELLQNRD---------- 182
            ..:.....:.::|.   .|.:..:.|.:.....:.||..:|     .:|..|:.|          
Zfish   432 NTYSGILNASKQRHSALWRRKSKADARQPSVHNEQATGDENEEKEEEEEESQSPDEESSEEDTDV 496

  Fly   183 ---ICEGNCSRGEKCPTGVCNMDPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSS---AA 241
               :||.....||                   ..:|:::..|..|.|:..:||.|.|...   :.
Zfish   497 FEQMCENVLDTGE-------------------AESATSNQFLSIQESDKVSSSPSRSGRMDLFSL 542

  Fly   242 AQSCPTSPK----NSPLPIVRR-SVGNERIPEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQ 301
            .||.....:    :..:.:.:| |.|..|           .:..|....|..|..||..|...||
Zfish   543 MQSIQLDDEDRGMDKEMSVCQRLSPGQRR-----------RSQGRRGLTYQRAHVDASPEPSSRQ 596

  Fly   302 LQ 303
            .|
Zfish   597 TQ 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 35/132 (27%)
si:ch211-203d1.3XP_021328548.1 SSH-N 3..230 CDD:212166
DEK_C 243..294 CDD:312337
DSPc 299..434 CDD:238073 35/131 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.