DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and LOC100492691

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_031762253.1 Gene:LOC100492691 / 100492691 -ID:- Length:182 Species:Xenopus tropicalis


Alignment Length:155 Identity:52/155 - (33%)
Similarity:83/155 - (53%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPR------RLLPDKHYLCVMASDTPDQ 61
            |:.:|.|.|::|:...:.|.::|::..|:||: |.|.|..      ...|:..|..:.|.|.|..
 Frog    27 HVDQVFPSLFLGDVVIANDKSKLKKMGITHILNAAHASWECTGDGIDYGPEIQYYGITAEDCPQF 91

  Fly    62 NLSQYFSVCNDFIH-AARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVA 125
            |:..:|....:||| |.....|.:|:||:.|.|||.|:.:||:|...|.:.::|::.|...|.:|
 Frog    92 NMRLFFYPAAEFIHKALNTPNGKILVHCVLGKSRSATLVLAYLMIYQHFSLEDAIRHVAKRRCIA 156

  Fly   126 NPNAGFQSQLQEFEQFKLSEERRRL 150
             ||.||..|||..|    :|:..||
 Frog   157 -PNRGFLEQLQSLE----AEQHSRL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 48/142 (34%)
LOC100492691XP_031762253.1 DUSP3-like 28..169 CDD:350365 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.