DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp18

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002931751.1 Gene:dusp18 / 100491030 XenbaseID:XB-GENE-1018365 Length:187 Species:Xenopus tropicalis


Alignment Length:136 Identity:43/136 - (31%)
Similarity:72/136 - (52%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH-DSPRRLLPDKHYLCVMASDTPDQNLSQYFS 68
            :..:..|||:.:.:.:::...|....|:.:|.:. :..:...|:..|:.:...||||..|.|||.
 Frog    19 LNSISEGLYLASAKAARNRTLLATHCITCVINVSLEIDKNESPELEYVHIPVPDTPDTCLLQYFD 83

  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133
            ...|.||..::..|:.|:||:||:|||.|:.:||:|....|:...|...|:..|.:..||.||..
 Frog    84 DIADKIHNIKVSGGSTLLHCVAGISRSPTLCLAYLMKYHSLSLLAAHARVKMCRPIIRPNLGFWK 148

  Fly   134 QLQEFE 139
            ||..:|
 Frog   149 QLMSYE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 42/134 (31%)
dusp18XP_002931751.1 PTP_DSP_cys 18..175 CDD:391942 43/136 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.