DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and ssh3

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002938546.1 Gene:ssh3 / 100488263 XenbaseID:XB-GENE-5816848 Length:688 Species:Xenopus tropicalis


Alignment Length:373 Identity:85/373 - (22%)
Similarity:144/373 - (38%) Gaps:91/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK-HYLCVMASDTPDQNLSQYFSVC 70
            ::.|.||:|:..::.:..:|::.|:|||:.:........|:. .||.:...|..:.||.||:...
 Frog   299 EIFPYLYLGSEWNASNLEELQKNKVSHILNVTREIDNFFPELFKYLNIRVLDEENTNLMQYWKET 363

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            :.||.|.|.:...||:||..|:|||.:..:||.|.......:.|::.|:..|.:..|||||..||
 Frog   364 HAFITAGRRQGSRVLVHCKMGVSRSASTVIAYAMKEYEWTLETAMRHVKERRNIVQPNAGFIRQL 428

  Fly   136 QEFEQFKLSEERRR-----------LRERFP----------SSALEQLDRTKVATALDNYQELLQ 179
            |.::....:.::|.           |.:.||          |....:|.:..:.|.:        
 Frog   429 QTYQGILGASKQRHSYLWDPSSAPPLPQVFPPPKNFSRHTTSPLTPRLQKMNLRTLM-------- 485

  Fly   180 NRDICEGNCSRGEKCPTGVCNMDPTKGLFRRRPSNASTHSRLRAQSSN-ANASSSSLSVSSAAAQ 243
             |.|.|               ||.|..:...:.|.:.....:..|..| ..::|.:|.       
 Frog   486 -RSISE---------------MDATDTISEEKESTSELEENIFKQKVNILESTSKNLQ------- 527

  Fly   244 SCPTSPKNSPLPIVRRSV---------GNERIPEDEI---VLEQPPTTS-----REAAEYAAAFE 291
              .|.||.:...:.:..:         ..|:.||.|:   .|::...|.     :||.|     :
 Frog   528 --GTFPKRNEHVLYKEQITLEEDKKLMKLEKGPESEVKNHTLQEIKETEVSIRLKEAKE-----K 585

  Fly   292 DARREQEQRQLQQQQQLSRSQRSPRPVNSSREAPRVSSAGSRRESAAR 339
            |....:|...:.||             |||.:....||..:|....||
 Frog   586 DQETNKESSSITQQ-------------NSSLDEVFESSTPTRSPQMAR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 43/132 (33%)
ssh3XP_002938546.1 SSH-N 3..231 CDD:212166
DEK_C 238..291 CDD:370106
PTP_DSP_cys 294..437 CDD:391942 43/137 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.