DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and ssh2

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_004911756.2 Gene:ssh2 / 100488169 XenbaseID:XB-GENE-993093 Length:1419 Species:Xenopus tropicalis


Alignment Length:486 Identity:95/486 - (19%)
Similarity:161/486 - (33%) Gaps:156/486 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDK-HYLCVMASDTPDQNLSQYFSVC 70
            ::...:::|:..::.:...|:...:.:|:.:........|.. .|..:...|....:|..|::..
 Frog   336 EIFDHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGLFEYHNIRVYDEEGTDLLAYWNDT 400

  Fly    71 NDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQL 135
            ..||..|:......|:||..|:|||.:..:||.|.....|...|...|:..|.|..||..|..||
 Frog   401 FKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAFDYVKERRTVTKPNPSFMKQL 465

  Fly   136 QEFEQFKLSEERR-------------------------RLRERFPSSALEQLDRTKVA------- 168
            :|::...|:.::|                         .:.::..:|:.|||..|..:       
 Frog   466 EEYQGILLASKQRHNKLWRSHSDSDLSDHHEPVGKTGLEMSKKDITSSAEQLSDTHHSFSLGPHT 530

  Fly   169 -----------------------TALDNYQELLQNRDICEGNCSRGEKCPTGVCNMDP------- 203
                                   |:.|.:.|  |..||...|...|  ||:..|:.|.       
 Frog   531 ENCNPDCPMDSTLYNETQARFEFTSCDFHTE--QIEDILNLNTMNG--CPSRCCSDDTILDNCRI 591

  Fly   204 -TKGLFRR-----------------------RPSNASTHSRLRAQSS---NANASSSSLSVSSAA 241
             .|.|.:.                       :|.....|..|...:|   :...|...||::|.:
 Frog   592 VEKDLTQNPESFTVPGQLPDLTLEDMEKDALKPEVNCHHLHLEGLNSDFRDLQESPDQLSMTSQS 656

  Fly   242 AQ-------------------------SCPT-------SPKNSPL-------PIVRRSVGNERIP 267
            .:                         ||.|       |.|||.|       |:....|.|:||.
 Frog   657 EELNGDRIDFLSALEKFVELSQENRPRSCSTTRADEVSSVKNSALKASWPETPVYDSHVDNQRIS 721

  Fly   268 EDEIVLEQPPTTSREAAEYAAAFEDARREQEQ-RQLQQQQQLSRSQRSPRPVNSSREAPRVSSAG 331
            .|       .:||:.:       ||:..::|| :::.:|     ..:.|.|.:.|..|..|....
 Frog   722 SD-------GSTSQTS-------EDSSTDEEQPKEISEQ-----IVQEPLPKSHSENAISVKEII 767

  Fly   332 SRRESAAREGNGSAQLQRSASTVSGFGVRPR 362
            :..||.   ..|:.|.|:...|.|.....|:
 Frog   768 TEIESF---NQGAGQCQQKPDTQSSQSQTPK 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 32/132 (24%)
ssh2XP_004911756.2 SSH-N 43..262 CDD:212166
DEK_C 276..328 CDD:400903
DSP_slingshot_2 331..474 CDD:350417 32/137 (23%)
MDN1 <634..974 CDD:227596 39/184 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.