DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp10

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_003200822.1 Gene:dusp10 / 100034609 ZFINID:ZDB-GENE-041014-271 Length:459 Species:Danio rerio


Alignment Length:148 Identity:57/148 - (38%)
Similarity:81/148 - (54%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NWHMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI--HDSPRRLLPDKHY----LC---VMASD 57
            |..:..|||.||:||.||::|...|:|..|..::.:  |      ||..||    .|   :.|:|
Zfish   296 NAELTAVLPFLYLGNERDAQDLELLQRLDIGFVLNVTTH------LPLYHYDIARFCYKRLPATD 354

  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            :..|||.|||....:||..|......:||||.||:|||.|:.:||:|..|.:...:|.|.|::.|
Zfish   355 SNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYKFVKSRR 419

  Fly   123 AVANPNAGFQSQLQEFEQ 140
            .:.:||..|..||.|||:
Zfish   420 PIISPNLNFMGQLLEFEE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 54/143 (38%)
dusp10XP_003200822.1 DSP_MapKP 127..262 CDD:238723
DSPc 298..436 CDD:238073 54/143 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.