DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and si:dkey-175m17.7

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_001345798.1 Gene:si:dkey-175m17.7 / 100007304 ZFINID:ZDB-GENE-091204-18 Length:904 Species:Danio rerio


Alignment Length:142 Identity:53/142 - (37%)
Similarity:74/142 - (52%) Gaps:15/142 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLPGLYVGNYRDSKDHAQLERFKISHIIAI--HDSPRRLLPDKH-------YLCVMASDTPDQNL 63
            :||.|::||.||::|...|....|..::.:  |      ||..|       |..:.|:|...|||
Zfish   747 ILPFLFLGNERDAQDLDLLLHLNIGFVVNVTTH------LPLYHLDTGLVRYKRLPATDNSKQNL 805

  Fly    64 SQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPN 128
            .|||....:||..|......||:||.||:|||.|:.:||:|..|.:...:|.|.||..|.:.:||
Zfish   806 RQYFEEVFEFIEEAHQCGRGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRGRRPIVSPN 870

  Fly   129 AGFQSQLQEFEQ 140
            ..|..||.|||:
Zfish   871 LNFMGQLLEFER 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 51/139 (37%)
si:dkey-175m17.7XP_001345798.1 SARG 107..>311 CDD:317751
DSPc 744..881 CDD:238073 51/139 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.