DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10089 and dusp3a

DIOPT Version :9

Sequence 1:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_001340818.2 Gene:dusp3a / 100000665 ZFINID:ZDB-GENE-111207-3 Length:200 Species:Danio rerio


Alignment Length:154 Identity:46/154 - (29%)
Similarity:79/154 - (51%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRLLPDKH----------YLCVMASDT 58
            |..:|.|.:|:||...:::..:|:|..::||:.:.:....:..:.:          |..:.|:||
Zfish    43 HFNEVFPRIYIGNAFVAQNVMRLQRLGVTHILNVAEGNSFMHVNTNAEFYAGTGITYHGIQANDT 107

  Fly    59 PDQNLSQYFSVCNDFIHAARLR-EGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122
            ...|:|.:|....|||..|... :|.|.:||..|.|||.|:.:||:|....::.:.|...||..|
Zfish   108 EQFNISAFFEEAADFIDKALAHGKGKVYVHCREGYSRSPTIVIAYLMLRHKMDVRVATATVRHKR 172

  Fly   123 AVANPNAGFQSQLQEFEQFKLSEE 146
            .: .||.||..||.:..: ||::|
Zfish   173 EI-GPNGGFLCQLCQLNE-KLAKE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 43/145 (30%)
dusp3aXP_001340818.2 DSPc 45..188 CDD:238073 42/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.