DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and adcy3a

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:XP_009290286.1 Gene:adcy3a / 571825 ZFINID:ZDB-GENE-111027-6 Length:1119 Species:Danio rerio


Alignment Length:313 Identity:94/313 - (30%)
Similarity:153/313 - (48%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 WAERPE--DRPDFKTIRTKLRPLRKGMRPNIFDNMMAM------MEKYANNL---EALVDDRTDQ 883
            |::..:  |...||..|..|.|.:..|...||..|::.      :||.|..|   :..|.::.::
Zfish   791 WSQTFDLYDLTRFKEYRVNLVPSKYTMSVMIFIMMVSFYYFSRHVEKLARTLFLWKIEVHEQKEK 855

  Fly   884 LQEEKKKTDALLHEMLPRCVADQLKKGHKVDPE----HYEQVSIYFSDIVGF----TAMSAECTP 940
            :.|.::..:||:..|||..||.......|.|.|    .|:::.:.|:.|..|    |..|.....
Zfish   856 VYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASIPNFSDFYTEESINNGG 920

  Fly   941 LQVVDFLNDLYTCFDSIIGHYD---VYKVETIGDAYMVVSGLPLRNGD----------------- 985
            ::.:.|||::.:.|||::....   :.|::|||..||..||:...|..                 
Zfish   921 IECLRFLNEIISDFDSLLDEPQFRCITKIKTIGSTYMAASGVTSDNNTNGYACMKKEEISDRERW 985

  Fly   986 LHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASR 1050
            .|.|::|..:|.:  .|:...|.::..|..:||||::.|.|.|||:|.:.|.:.::|:|||.|||
Zfish   986 QHLADLADFALAM--KVTLMNINYQSFNNFMLRIGLNKGAVLAGVIGARKPHFDIWGNTVNVASR 1048

  Fly  1051 MESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDEE 1103
            |||:||...|.....|..:|... |:.|..||.|.:||||:..||:|.|.:::
Zfish  1049 MESTGVMGNIQVVEDCYCILKDY-GFRFVRRGPIFVKGKGELLTYFLKGREKQ 1100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 7/24 (29%)
TyrKc 597..847 CDD:197581 5/18 (28%)
HNOBA <862..907 CDD:285003 14/53 (26%)
CYCc 886..1078 CDD:214485 66/219 (30%)
Guanylate_cyc 913..1099 CDD:278633 68/213 (32%)
adcy3aXP_009290286.1 AC_N <37..304 CDD:292831
CYCc 273..468 CDD:214485
Guanylate_cyc 310..492 CDD:278633
CYCc 858..1075 CDD:214485 66/219 (30%)
Guanylate_cyc 889..1096 CDD:278633 66/209 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.