DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and adcy5

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001165056.1 Gene:adcy5 / 562619 ZFINID:ZDB-GENE-081104-470 Length:1186 Species:Danio rerio


Alignment Length:303 Identity:88/303 - (29%)
Similarity:138/303 - (45%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   857 NIFDN--MMAMMEKYA-NNLEALVDDRTD-----------------------------------Q 883
            ::|||  ::.|....| ||...:||.|..                                   |
Zfish   882 SLFDNVDLLVMANALAPNNGTCIVDTRVPLKIVTPVVITVFVLALYLHAQQVESTARLDFLWKLQ 946

  Fly   884 LQEEKKKTD-------ALLHEMLPRCVADQLKKGHKVDPEHYEQ----VSIYFSDIVGFT----A 933
            ..|||::.:       .|||.:||:.||.......:.:.|.|.|    |::.|:.|..|:    .
Zfish   947 ATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYVE 1011

  Fly   934 MSAECTPLQVVDFLNDLYTCFDSIIGH---YDVYKVETIGDAYMVVSGLP----LRNGDLHAAEI 991
            :.|....::.:..||::...||.||..   ..:.|::|||..||..|||.    .:.|..|...:
Zfish  1012 LEANNEGVECLRLLNEIIADFDEIISEDQFRQLEKIKTIGSTYMAASGLNDSTYDKAGRSHIRAL 1076

  Fly   992 ATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGV 1056
            |..::.|:..:.  .|.....|...::||::.|||.|||:|.:.|:|.::|:|||.||||:|:||
Zfish  1077 ADYAMRLMDQMK--YINEHSFNNFKMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGV 1139

  Fly  1057 PLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLG 1099
            |.:|..:....|:|... .|....|||:.:||||:..||:|.|
Zfish  1140 PERIQVTTDLYQVLSSY-NYTLEYRGVVKVKGKGEMMTYFLNG 1181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 18/87 (21%)
CYCc 886..1078 CDD:214485 66/213 (31%)
Guanylate_cyc 913..1099 CDD:278633 66/200 (33%)
adcy5NP_001165056.1 AC_N 1..388 CDD:292831
CYCc 354..548 CDD:214485
Guanylate_cyc 390..574 CDD:278633
DUF1053 598..687 CDD:283888
CYCc 961..1155 CDD:214485 62/195 (32%)
Guanylate_cyc 987..1181 CDD:278633 65/196 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.