DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and ADCY10

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_060887.2 Gene:ADCY10 / 55811 HGNCID:21285 Length:1610 Species:Homo sapiens


Alignment Length:552 Identity:110/552 - (19%)
Similarity:170/552 - (30%) Gaps:221/552 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 IASMVADIIRGVIYLHDSPIR-----FHGALC--------------TSNCLVD--SRWVVKLTDF 717
            ||:.:.|:|   :|.|.||.|     |.|.|.              :|...:|  :..:|::.::
Human    16 IAAHLPDLI---VYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNY 77

  Fly   718 GLFAFKQGIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVM-------GTQRGDAYSFG---- 771
            .:.|..:.:.....|:...:...|..|:|......:...::|:       |......:..|    
Human    78 HISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLDIR 142

  Fly   772 --ILLYEMHVRRGPFGE----------TGLTPMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSE 824
              |.|...|:....||:          ..:..::..|.:.|..|.:      |.|          
Human   143 VKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQNMAQMNDVI------LSP---------- 191

  Fly   825 CLRECW--AERP----EDRPDFKTIRTK-LRPLRKGMRPN-----IFDNMMAMMEKYANNLEALV 877
               .||  .:|.    |..||.:.::.. |:|     .||     .|......|..|.:.     
Human   192 ---NCWQLCDRSMIEIESVPDQRAVKVNFLKP-----PPNFNFDEFFTKCTTFMHYYPSG----- 243

  Fly   878 DDRTDQLQEEKK--------KTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAM 934
                    |.|.        |.|..|...|.:.|.:.:.|  ::|   .:|:..|.|        
Human   244 --------EHKNLLRLACTLKPDPELEMSLQKYVMESILK--QID---NKQLQGYLS-------- 287

  Fly   935 SAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIG----DAYM-VVSGLPLRNGDL-------- 986
              |..|:.:| |:|.::.         |..|.|.||    |||| :.|.|.:..|.:        
Human   288 --ELRPVTIV-FVNLMFE---------DQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDK 340

  Fly   987 --------------------HAAEIA------TMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGP 1025
                                ||.|.|      ...:|.:..||               ||:.||.
Human   341 GCSFLCVFGFPGEKVPDELTHALECAMDIFDFCSQVHKIQTVS---------------IGVASGI 390

  Fly  1026 VCAGVVGLKM-PRYCLFGDTVNTASRM---------------ESSGVPLKIHCSWQCRQLLDRLG 1074
            |..|:||..: ..|.:.|..||.|:||               ..|.:|                 
Human   391 VFCGIVGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLP----------------- 438

  Fly  1075 GYHFAERGVISMKGKGDQ---RTYWLLGEDEE 1103
            .|.|.|.....|||..|.   ..||  |..|:
Human   439 AYFFKELPKKVMKGVADSGPLYQYW--GRTEK 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 41/229 (18%)
TyrKc 597..847 CDD:197581 39/223 (17%)
HNOBA <862..907 CDD:285003 9/52 (17%)
CYCc 886..1078 CDD:214485 54/254 (21%)
Guanylate_cyc 913..1099 CDD:278633 54/243 (22%)
ADCY10NP_060887.2 CHD 40..214 CDD:143636 29/192 (15%)
AcyC <42..197 CDD:225025 24/173 (14%)
CHD 292..461 CDD:143636 46/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.