DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and Gucy1a1

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_058786.2 Gene:Gucy1a1 / 497757 RGDID:68436 Length:690 Species:Rattus norvegicus


Alignment Length:238 Identity:106/238 - (44%)
Similarity:142/238 - (59%) Gaps:9/238 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 PLRKGMRPNIFDNMMAM----MEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKK 909
            |:...:|..:.....|.    ::|....|:|.::.....|:||||||..||..:.|..||.||.:
  Rat   403 PIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEEEKKKTVDLLCSIFPSEVAQQLWQ 467

  Fly   910 GHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYM 974
            |..|..:.:.:|::.|||||||||:.::|:||||:..||.|||.||...|..||||||||||||.
  Rat   468 GQIVQAKKFNEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYC 532

  Fly   975 VVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRH-RPTNRLLLRIGIHSGPVCAGVVGLKMPRY 1038
            |..||. |..|.||.:||.|:|.::...:|....| .|   :.:|||:|||.|.|||||:|||||
  Rat   533 VAGGLH-RESDTHAVQIALMALKMMELSNEVMSPHGEP---IKMRIGLHSGSVFAGVVGVKMPRY 593

  Fly  1039 CLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAER 1081
            ||||:.|..|::.||..||.||:.|....:||....|:.|..|
  Rat   594 CLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPR 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 1/3 (33%)
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 16/48 (33%)
CYCc 886..1078 CDD:214485 97/192 (51%)
Guanylate_cyc 913..1099 CDD:278633 85/170 (50%)
Gucy1a1NP_058786.2 HNOB <111..234 CDD:285002
HNOBA 276..465 CDD:285003 18/61 (30%)
CYCc 444..633 CDD:214485 97/192 (51%)
Guanylate_cyc 471..642 CDD:278633 85/170 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.