DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and NPR3

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:526 Identity:122/526 - (23%)
Similarity:195/526 - (37%) Gaps:116/526 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AISLAVEEVNAG----RLRDRGHSLQFVVAETYGEEVVSIRQTAALWTQQVAA-------YIGPQ 121
            ||..|:..|...    ||...|  .:|.||  |.:.....|...:|..:..||       .:|| 
Human    75 AIEYALRSVEGNGTGRRLLPPG--TRFQVA--YEDSDCGNRALFSLVDRVAAARGAKPDLILGP- 134

  Fly   122 ETCVHE----GRMAAAFNLPMISYYC-----THRDPSNKADFPTFARTRPPDTQISKSVVALLLA 177
             .|.:.    .|:|:.::|||:|...     .|:|    :::....|..|...::.:.::||...
Human   135 -VCEYAAAPVARLASHWDLPMLSAGALAAGFQHKD----SEYSHLTRVAPAYAKMGEMMLALFRH 194

  Fly   178 FNWTQVSFLYLDD---------ASGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHG-FMDNPF 232
            .:|::.:.:|.||         ..|.::...|..|.|               :||... ..|...
Human   195 HHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHT---------------SIYSFDETKDLDL 244

  Fly   233 EALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRGLLL 297
            |.:|....|:.|:.::.........:|:...|.|:.| |||....|::..........:.|| ..
Human   245 EDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTS-GDYAFFNIELFNSSSYGDGSWKRG-DK 307

  Fly   298 EDVEPLAVQAFQSY--LGIVPTASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYL 360
            .|.|  |.||:.|.  :.::.|....|..|:.||...:|:...|..:.:..|         ....
Human   308 HDFE--AKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMF---------VEGF 361

  Fly   361 YDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARGSVR 425
            :||:.||..||.|||.:|...::|..|:.......:....| .|.||.|||..|:::|:|...|.
Human   362 HDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAG-QVSIDANGDRYGDFSVIAMTDVE 425

  Fly   426 NGRNQTVLG----------LRPVGTF--------IHRNSSLSSISKALPHQNLKLFSPIDWVGGT 472
            .| .|.|:|          :||...:        |..|       :.:.|.|   .||....||.
Human   426 AG-TQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDEN-------RIVEHTN---SSPCKSSGGL 479

  Fly   473 RPAAAPRCGFGGEKCVNYTGEISAAIAGGALLLLSLVSLVLYR---NWRYEQELDSLLWKIDFRE 534
            ..:|.             ||.:..|:.|..||:........||   ..|.:||..:|....:.||
Human   480 EESAV-------------TGIVVGALLGAGLLMAFYFFRKKYRITIERRTQQEESNLGKHRELRE 531

  Fly   535 VQIHEN 540
            ..|..:
Human   532 DSIRSH 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365 98/414 (24%)
ANF_receptor 67..416 CDD:279440 89/379 (23%)
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003
CYCc 886..1078 CDD:214485
Guanylate_cyc 913..1099 CDD:278633
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 96/410 (23%)
ANF_receptor 71..422 CDD:279440 91/385 (24%)
TM_EphA1 476..507 CDD:214014 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.