DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and CG14877

DIOPT Version :10

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:59/167 - (35%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 DVKLDNMFIASMVADIIRGVIYLHDSPIR-----FHGALCTSNCLVDSRWVVKLTDFGLFAFKQG 725
            |.|.|    ||:      |||...|..|:     ..|.:|..:....|| :.|      :...||
  Fly    90 DTKCD----ASL------GVIKAMDGIIKQCAQVIFGPVCDYSLAAVSR-ITK------YFNSQG 137

  Fly   726 -----IEDSSTDMQHMSAKCLKLLYRAPELLRQGP------SSLVMGTQRGDAYSFGILLYEMHV 779
                 :..|:.|.:.....|....|.   |||.|.      |.|.:...:...:|..|..||...
  Fly   138 TPLISVGGSTYDFEQKKTDCNDEFYM---LLRTGMLSFETISELTINVMKRHNWSHSIFYYERDG 199

  Fly   780 RRGPFG-ETGLTPMQCLQKVLQPQDYL---NPYRPSL 812
            :|...| .|....|:.|.|.::.::..   .|..|:|
  Fly   200 QRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_SAP_GC-like 41..441 CDD:380593
PK_GC-A_B 570..853 CDD:270944 40/167 (24%)
HNOBA <860..907 CDD:462234
CYCc 886..1078 CDD:214485
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960 40/167 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.