DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and ACXD

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster


Alignment Length:400 Identity:94/400 - (23%)
Similarity:165/400 - (41%) Gaps:111/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   879 DRTDQLQEE------KKKTDALLHEMLPRCVADQL-----------KKGH----KVD-------- 914
            ||...::|.      :.:..:||..:||..:||:|           |:.|    :||        
  Fly   241 DRRQYVEENLLLRYARDQERSLLLSILPAQIADRLQEDVKNRIERSKQQHQQQSQVDLRRSADSQ 305

  Fly   915 -------PEH-------YEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYK 965
                   |:|       :|.|::.::|:|.:|.::......::|:.|:||:..||.....|:|.:
  Fly   306 TLKRWRQPDHGTLFIEPHEDVTVLYADVVNYTHLTTTLDVKKLVEALHDLFVRFDIASEEYNVLR 370

  Fly   966 VETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGV 1030
            ::.:||.|..|:||...|.| ||.....:.|.::..:.:  :|.:....:.:|||:|||.|.:||
  Fly   371 IKFLGDCYYCVAGLANPNAD-HAKCCVDLGLRMIKDIRD--VREKRHLNIDMRIGVHSGDVLSGV 432

  Fly  1031 VGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTY 1095
            :|....::.::...|:.|:|:|::|...::|.|.:...|||   |.:|.|.|.            
  Fly   433 IGAAKWQFDIWSKDVDIANRLEATGATGRVHVSQKTLSLLD---GEYFFEDGT------------ 482

  Fly  1096 WLLGEDEEARTRRTYERSQRRGSRALNKFIQGTIKQAQEQANEYGIRSSL-KQKNLPRNSLTRSS 1159
                  |:||.....::                          :|||:.| |....|.:...|..
  Fly   483 ------EKAREDPVLQK--------------------------HGIRTFLIKSLRAPMHDPRRRM 515

  Fly  1160 SLESPKKLRFAAGSLLEH----HRYHS--DEALLEV-----------DSYTGLRRSSGGSTQSRY 1207
            .....|||..|:.:...|    |:|:.  ::|.||:           ...|.:.|.|...||...
  Fly   516 RERQVKKLSEASKANFMHNSTLHQYNQVRNQAKLEMCRELDKMPIGRIQLTKVFRRSTRLTQDEI 580

  Fly  1208 EETTLSLTLS 1217
            ||.|....:|
  Fly   581 EEETFRRNIS 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 9/33 (27%)
CYCc 886..1078 CDD:214485 60/234 (26%)
Guanylate_cyc 913..1099 CDD:278633 53/207 (26%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831 10/42 (24%)
CYCc 254..476 CDD:214485 59/227 (26%)
Nucleotidyl_cyc_III 321..503 CDD:299850 56/231 (24%)
CYCc 856..1117 CDD:214485
Nucleotidyl_cyc_III 878..1142 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.