DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and Adcy8

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_058838.1 Gene:Adcy8 / 29241 RGDID:2036 Length:1248 Species:Rattus norvegicus


Alignment Length:370 Identity:106/370 - (28%)
Similarity:167/370 - (45%) Gaps:60/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   883 QLQEEKKKTDALLHEMLPR-CVADQLKKGHKVDPEH------------YEQVSIYFSDIVGFTAM 934
            :|:.|.::.:.|:..:||| .|.:.:.....|:.||            ||.|||.|:|:.|||.:
  Rat   359 RLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNL 423

  Fly   935 SAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLL 999
            |...:..::|..||:|:..||.:...:...:::.:||.|..|||||....| ||.....|.|.::
  Rat   424 STTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQD-HAHCCVEMGLSMI 487

  Fly  1000 SAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSW 1064
            ..: .| :|.|..:.:.:|||||||.|..||:||:..::.::...|:.|:::||.|:|.:||.| 
  Rat   488 KTI-RF-VRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHIS- 549

  Fly  1065 QCRQLLDRLGGYHFAERGVISMKGKGDQR----------TYWLLGEDEEAR-------TRRTYER 1112
              :..||.|.|.:..|      :|.|.:|          || |:.:.||:.       .:.:...
  Rat   550 --KATLDCLSGDYNVE------EGHGKERNEFLRKHNIETY-LIKQPEESLLSLPEDIVKESVSC 605

  Fly  1113 SQRRGSRALNKFIQGTIKQAQEQANEYGIRSSLKQKNLPRNSLTRSSSLESPKKLRFAAGSLLEH 1177
            |.||.|.|  .|.:|:........|..|     ||..|.  :|||:|....|..|..|.     |
  Rat   606 SDRRNSGA--TFTEGSWSPELPFDNIVG-----KQNTLA--ALTRNSINLLPNHLAQAL-----H 656

  Fly  1178 HRYHSDEALLEVDSYTGLRRSSGGSTQSRYEETTLSLTLSCQSIE 1222
            .:...:|....::....||   .|....|......||.....|:|
  Rat   657 VQSGPEEINKRIEHTIDLR---SGDKLRREHIKPFSLMFKDSSLE 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 7/24 (29%)
CYCc 886..1078 CDD:214485 67/204 (33%)
Guanylate_cyc 913..1099 CDD:278633 68/207 (33%)
Adcy8NP_058838.1 Involved in ORAI1, STIM1, PPP2CA and PPP2R1A interaction. /evidence=ECO:0000269|PubMed:16258073, ECO:0000269|PubMed:22494970, ECO:0000269|PubMed:22976297 1..179
Involved in AKAP5 and PRKAR2A interaction. /evidence=ECO:0000269|PubMed:22976297 1..106
Essential for CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 38..40
Essential for CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 49..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..117
AC_N <158..397 CDD:292831 10/37 (27%)
CYCc 363..561 CDD:214485 67/203 (33%)
Guanylate_cyc 402..586 CDD:278633 65/196 (33%)
DUF1053 614..708 CDD:283888 24/100 (24%)
CYCc 941..1145 CDD:214485
Guanylate_cyc 970..1169 CDD:278633
Involved in CALM1 interaction. /evidence=ECO:0000269|PubMed:16258073 1106..1248
Required for both calcium stimulation and maintenance of autoinhibition. /evidence=ECO:0000269|PubMed:19305019 1197..1212
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1220..1248
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.