DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and Npr3

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:457 Identity:104/457 - (22%)
Similarity:175/457 - (38%) Gaps:85/457 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IGPQETCVHE----GRMAAAFNLPMISYYC-----THRDPSNKADFPTFARTRPPDTQISKSVVA 173
            :||  .|.:.    .|:|:.::|||:|...     .|:|    .::....|..|...::.:.::|
  Rat   243 LGP--VCEYAAAPVARLASHWDLPMLSAGALAAGFQHKD----TEYSHLTRVAPAYAKMGEMMLA 301

  Fly   174 LLLAFNWTQVSFLYLDD---------ASGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMD 229
            |....:|::.:.||.||         ..|.::...|..|.|........:|:             
  Rat   302 LFRHHHWSRAALLYSDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDL------------- 353

  Fly   230 NPFEALVEQTYANTRIYLILGHYYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKPEKYLRG 294
             ..:.:|.....:.|:.::.........:|:::.|.|:.| |||....|::..........:.||
  Rat   354 -DLDDIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTS-GDYAFFNIELFNSSSYGDGSWKRG 416

  Fly   295 LLLEDVEPLAVQAFQSY--LGIVPTASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEA 357
             ...|.|  |.||:.|.  :.::.||...|..|:.||...:|:...|..:.:..|         .
  Rat   417 -DKHDFE--AKQAYSSLQTVTLLRTAKPEFEKFSMEVKSSVEKQGLNEEDYVNMF---------V 469

  Fly   358 AYLYDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLARG 422
            ...:||:.||..||.|||.:|...::|..|:.......:....| .|.||.|||..|:::|:|..
  Rat   470 EGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAG-QVSIDANGDRYGDFSVVAMT 533

  Fly   423 SVRNGRNQTVLG--LRPVGTFIHRNS------SLS---SISKALPHQNLKLFSPIDWVGGTRPAA 476
            ....| .|.|:|  ....|.|..|::      ||.   ..::.:.|.|   .||....||...:|
  Rat   534 DTEAG-TQEVIGDYFGKEGRFKMRSNVKYPWGSLKLRIDETRIVEHTN---SSPCKSSGGLEESA 594

  Fly   477 APRCGFGGEKCVNYTGEISAAIAGGALLLLSLVSLVLYR---NWRYEQELDSLLWKIDFREVQIH 538
            .             ||.:..|:.|..||:........||   ..|..||..::....:.||..|.
  Rat   595 V-------------TGIVVGALLGAGLLMAFYFFRKKYRITIERRNHQEESNIGKHRELREDSIR 646

  Fly   539 EN 540
            .:
  Rat   647 SH 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365 79/344 (23%)
ANF_receptor 67..416 CDD:279440 72/317 (23%)
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003
CYCc 886..1078 CDD:214485
Guanylate_cyc 913..1099 CDD:278633
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 80/347 (23%)
ANF_receptor 182..535 CDD:279440 74/325 (23%)
TM_EphA1 587..618 CDD:214014 9/43 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.