DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and acy-3

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_497765.4 Gene:acy-3 / 175489 WormBaseID:WBGene00000070 Length:1243 Species:Caenorhabditis elegans


Alignment Length:331 Identity:76/331 - (22%)
Similarity:141/331 - (42%) Gaps:53/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   871 NNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQ------LKKGHKVDPEHYEQVSIYFSDIV 929
            |:.||   :.|.:.|  ..:.:.||...||..:.:|      |.|.|..: |.|.|||:.:..:|
 Worm   179 NSSEA---ESTAEFQ--SNRLNKLLSSFLPYHLINQARHQITLYKPHLYN-ETYSQVSVAYGRLV 237

  Fly   930 GFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIG-DAYMVVSGLPLRNGDLHAAEIAT 993
            ||.::.|:|:.:.....|.:|.:..:.:.......:|.:.| .|...:.|:..:    ||.::..
 Worm   238 GFESVLAQCSSIDAARVLKELDSRIERLAASNGCTRVASEGITAVCSIPGIDSQ----HATKLCR 298

  Fly   994 MSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPL 1058
            .|:.|.:.::.|  |......:.:.|||.||||.|||||:....|.:.|...:.|..|:|:....
 Worm   299 FSMELETLINSF--RDATGADVSVCIGIDSGPVTAGVVGVSKWHYDVIGSVFDNALLMQSNATEP 361

  Fly  1059 KIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDEEARTRRTYERSQRRGSRALNK 1123
            .::.|.:.|:.|...|.:.. |:..|..|      .|..|...|.....:.:  |.....:|:|:
 Worm   362 GVYVSNETRRFLGSTGEFEL-EKCPIGWK------LYGHLPSPELFPVNKRF--SLVTVPQAVNR 417

  Fly  1124 FIQGTI-------------KQAQEQANEYGIRSSLKQKNLPRNSL--TRSSSLESPKKLRFAAGS 1173
            .:|..:             |:..|::.|   :..:::|.:..:::  |.|....:|       |.
 Worm   418 VLQSIVAMNPTLKTMGTNKKRKGEKSQE---KFDMQKKKVEHSTIISTLSQRFRNP-------GL 472

  Fly  1174 LLEHHR 1179
            ..|:|:
 Worm   473 EAEYHK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 10/41 (24%)
CYCc 886..1078 CDD:214485 51/198 (26%)
Guanylate_cyc 913..1099 CDD:278633 47/186 (25%)
acy-3NP_497765.4 TctB 26..137 CDD:284693
CYCc 195..378 CDD:214485 50/189 (26%)
Nucleotidyl_cyc_III 221..382 CDD:299850 43/168 (26%)
CYCc 696..873 CDD:214485
Nucleotidyl_cyc_III 711..880 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.