DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and Adcy7

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:XP_006530643.1 Gene:Adcy7 / 11513 MGIID:102891 Length:1146 Species:Mus musculus


Alignment Length:411 Identity:101/411 - (24%)
Similarity:177/411 - (43%) Gaps:101/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   883 QLQEEKKKTDALLHEMLPR--------CVADQLKKG-----------HKVDPEHYEQVSIYFSDI 928
            :|:.||::.:.||..:||.        .:.::||:|           |.:..:.::.|||.::||
Mouse   223 KLRVEKRQQENLLLSVLPAHISMGMKLAIIERLKEGGDRHYMPDNNFHSLYVKRHQNVSILYADI 287

  Fly   929 VGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIAT 993
            ||||.::::|:|.::|..||:|:..||.|....:..:::.:||.|..|||||: :...||.....
Mouse   288 VGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPV-SLPTHARNCVK 351

  Fly   994 MSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPL 1058
            |.|.:..|:.:  :|......:.:|:|||||.|..||:||:..:|.::...|:.|:|||::|||.
Mouse   352 MGLDICEAIKQ--VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPG 414

  Fly  1059 KIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDEEARTRRTY----ERSQR---- 1115
            ::|.:......||:  .|...:       |.|:||..:|     :....|||    .|||:    
Mouse   415 RVHITEATLNHLDK--AYEVED-------GHGEQRDPYL-----KEMNIRTYLVIDPRSQQPPPP 465

  Fly  1116 ---------------RGSRALNKFIQ--GTIK-------QAQEQANEYGIRSSLKQKNLPRNSLT 1156
                           |.|..:.::::  |..:       :....::|..|.:..:||.:|.....
Mouse   466 SHHLSKPKGDATLKMRASVRVTRYLESWGAARPFAHLNHRESVSSSETPISNGRRQKAIPLRRHR 530

  Fly  1157 RSSSLESPKKLRFAAGSLLEHHRYHSDEALLEVDSYTGLRRSSGGS------------------- 1202
            ......|||      |.|.:.   ..||.|..::..:..|.....|                   
Mouse   531 APDRSASPK------GRLEDD---CDDEMLSAIEGLSSTRPCCSKSDDFHTFGPIFLEKGFEREY 586

  Fly  1203 -----TQSRYEETTLSLTLSC 1218
                 .::||:....||...|
Mouse   587 RLVPIPRARYDFACASLVFVC 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 7/31 (23%)
CYCc 886..1078 CDD:214485 66/210 (31%)
Guanylate_cyc 913..1099 CDD:278633 61/185 (33%)
Adcy7XP_006530643.1 AC_N <75..251 CDD:318454 7/27 (26%)
Guanylate_cyc 272..422 CDD:306677 53/152 (35%)
DUF1053 487..593 CDD:399378 16/114 (14%)
Guanylate_cyc 890..1085 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.