DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and ADCY8

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001106.1 Gene:ADCY8 / 114 HGNCID:239 Length:1251 Species:Homo sapiens


Alignment Length:331 Identity:97/331 - (29%)
Similarity:156/331 - (47%) Gaps:49/331 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   868 KYANNLEAL----VDDRTDQLQEEKKKTDALLHEMLPRCVA----DQLKKGHKVDPEHYEQVSIY 924
            :|...|:.|    ..:..::::|.::..:.:|..:||..||    ::.:...::..:.|:.|.:.
Human   920 EYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDAVGVM 984

  Fly   925 FSDIVGF------TAMS---AECTPLQVVDFLNDLYTCFDSIIGH---YDVYKVETIGDAYMVVS 977
            |:.|.||      |.|:   .||..|     ||::...||.::|.   .|:.|::|||..||.||
Human   985 FASIPGFADFYSQTEMNNQGVECLRL-----LNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVS 1044

  Fly   978 GLPLRNGDL-----HAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPR 1037
            ||.......     |...:|..||.|..::.|  |.....|...|||||..|.|.|||:|.|.|:
Human  1045 GLSPEKQQCEDKWGHLCALADFSLALTESIQE--INKHSFNNFELRIGISHGSVVAGVIGAKKPQ 1107

  Fly  1038 YCLFGDTVNTASRMESSGVPLKIHCSWQCRQLL-DRLGGYHFAERGVISMKGKGDQ----RTYWL 1097
            |.::|.|||.||||:|:||..:|....:...:| |:  |:.|..||.|.:||..:|    :||:|
Human  1108 YDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQ--GFAFDYRGEIYVKGISEQEGKIKTYFL 1170

  Fly  1098 LGEDEEARTRRTYERSQRR--GSRALNKFIQGTI----KQAQEQANEYGIRSSLKQKNLPRNSLT 1156
            ||..:.    ..:....||  |..:|...:.|.:    :|.|:|.......:.:.:.:..|.:|.
Human  1171 LGRVQP----NPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLL 1231

  Fly  1157 RSSSLE 1162
            ..|..|
Human  1232 SPSGTE 1237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 9/46 (20%)
CYCc 886..1078 CDD:214485 70/213 (33%)
Guanylate_cyc 913..1099 CDD:278633 74/207 (36%)
ADCY8NP_001106.1 Involved in ORAI1, STIM1, PPP2CA and PPP2R1A interaction. /evidence=ECO:0000250|UniProtKB:P40146 1..182
Involved in AKAP5 and PRKAR2A interaction. /evidence=ECO:0000250|UniProtKB:P40146 1..109
Essential for CALM1 interaction. /evidence=ECO:0000250|UniProtKB:P40146 38..40
Essential for CALM1 interaction. /evidence=ECO:0000250|UniProtKB:P40146 49..51
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..92
AC_N <161..400 CDD:292831
CYCc 366..564 CDD:214485
Guanylate_cyc 405..589 CDD:278633
DUF1053 617..711 CDD:283888
CYCc 944..1148 CDD:214485 69/212 (33%)
Guanylate_cyc 973..1172 CDD:278633 74/207 (36%)
Involved in CALM1 interaction. /evidence=ECO:0000250|UniProtKB:P40146 1109..1251 39/135 (29%)
Required for both calcium stimulation and maintenance of autoinhibition. /evidence=ECO:0000250|UniProtKB:P40146 1200..1215 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1223..1251 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.