DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and ADCY5

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens


Alignment Length:295 Identity:89/295 - (30%)
Similarity:141/295 - (47%) Gaps:43/295 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   835 EDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTD-----QLQEEKKKTD-- 892
            |..|:..|     :...|.:.|.|....:..:..:|..:|:..  |.|     |..|||::.:  
Human  1000 EQSPEHAT-----KVALKVVTPIIISVFVLALYLHAQQVESTA--RLDFLWKLQATEEKEEMEEL 1057

  Fly   893 -----ALLHEMLPRCVADQLKKGHKVDPEHYEQ----VSIYFSDIVGFT----AMSAECTPLQVV 944
                 .|||.:||:.||.......:.:.|.|.|    |::.|:.|..|:    .:.|....::.:
Human  1058 QAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECL 1122

  Fly   945 DFLNDLYTCFDSIIGH---YDVYKVETIGDAYMVVSGLPLRN-------GDLHAAEIATMSLHLL 999
            ..||::...||.||..   ..:.|::|||..||..|||   |       |..|...:|..::.|:
Human  1123 RLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGL---NDSTYDKVGKTHIKALADFAMKLM 1184

  Fly  1000 SAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSW 1064
            ..:.  .|.....|...::||::.|||.|||:|.:.|:|.::|:|||.||||:|:|||.:|..:.
Human  1185 DQMK--YINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTT 1247

  Fly  1065 QCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLG 1099
            ...|:| ....|....|||:.:||||:..||:|.|
Human  1248 DMYQVL-AANTYQLECRGVVKVKGKGEMMTYFLNG 1281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 3/17 (18%)
TyrKc 597..847 CDD:197581 3/11 (27%)
HNOBA <862..907 CDD:285003 15/56 (27%)
CYCc 886..1078 CDD:214485 67/216 (31%)
Guanylate_cyc 913..1099 CDD:278633 67/203 (33%)
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 66/199 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.