Sequence 1: | NP_729905.2 | Gene: | CG10738 / 39516 | FlyBaseID: | FBgn0036368 | Length: | 1250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_066939.1 | Gene: | ADCY1 / 107 | HGNCID: | 232 | Length: | 1119 | Species: | Homo sapiens |
Alignment Length: | 250 | Identity: | 83/250 - (33%) |
---|---|---|---|
Similarity: | 129/250 - (51%) | Gaps: | 36/250 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 878 DDRTDQLQEEKKKTD--ALLHEMLPRCVADQ--LKKGHKVD--PEHYEQVSIYFSDIVGF----- 931
Fly 932 ----TAMSAECTPLQVVDFLNDLYTCFDSIIG---HYDVYKVETIGDAYMVVSGLPLRNG----- 984
Fly 985 --DLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT 1047
Fly 1048 ASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1102 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10738 | NP_729905.2 | PBP1_Speract_GC_like | 41..441 | CDD:107365 | |
ANF_receptor | 67..416 | CDD:279440 | |||
PK_GC-A_B | 570..853 | CDD:270944 | |||
TyrKc | 597..847 | CDD:197581 | |||
HNOBA | <862..907 | CDD:285003 | 11/32 (34%) | ||
CYCc | 886..1078 | CDD:214485 | 68/216 (31%) | ||
Guanylate_cyc | 913..1099 | CDD:278633 | 71/206 (34%) | ||
ADCY1 | NP_066939.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
AC_N | <161..292 | CDD:292831 | |||
CYCc | 258..453 | CDD:214485 | |||
Guanylate_cyc | 294..476 | CDD:278633 | |||
Interaction with calmodulin. /evidence=ECO:0000250 | 493..520 | ||||
CYCc | 826..1037 | CDD:214485 | 70/221 (32%) | ||
Guanylate_cyc | 859..1056 | CDD:278633 | 70/204 (34%) | ||
Interaction with calmodulin. /evidence=ECO:0000250 | 1024..1047 | 11/23 (48%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |