DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and ADCY1

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:250 Identity:83/250 - (33%)
Similarity:129/250 - (51%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   878 DDRTDQLQEEKKKTD--ALLHEMLPRCVADQ--LKKGHKVD--PEHYEQVSIYFSDIVGF----- 931
            ::|.|.   ||.|.|  .:|..:||..||..  :.....:|  .:.|.||.:.|:.|..|     
Human   821 EEREDM---EKVKLDNRRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYI 882

  Fly   932 ----TAMSAECTPLQVVDFLNDLYTCFDSIIG---HYDVYKVETIGDAYMVVSGLPLRNG----- 984
                ..|..||..|     ||::...||.::.   :.|:.|::|||..||...||...:|     
Human   883 ELDGNNMGVECLRL-----LNEIIADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKK 942

  Fly   985 --DLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNT 1047
              ..|.:.:|..::.:...:.|  |.::..|..:||:||:.|||.|||:|.:.|:|.::|:|||.
Human   943 SISSHLSTLADFAIEMFDVLDE--INYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNV 1005

  Fly  1048 ASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1102
            ||||:|:||..:|..:.:..:||.|. .|||..||.:|:||||:..||:|.|..:
Human  1006 ASRMDSTGVQGRIQVTEEVHRLLRRC-PYHFVCRGKVSVKGKGEMLTYFLEGRTD 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 11/32 (34%)
CYCc 886..1078 CDD:214485 68/216 (31%)
Guanylate_cyc 913..1099 CDD:278633 71/206 (34%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831
CYCc 258..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485 70/221 (32%)
Guanylate_cyc 859..1056 CDD:278633 70/204 (34%)
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047 11/23 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.