DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10738 and adcy7

DIOPT Version :9

Sequence 1:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster
Sequence 2:NP_001106549.1 Gene:adcy7 / 100127741 XenbaseID:XB-GENE-1005225 Length:1061 Species:Xenopus tropicalis


Alignment Length:263 Identity:82/263 - (31%)
Similarity:129/263 - (49%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   862 MMAMMEKYANNLEAL----VDDRTDQLQEEKKKTDALLHEMLPRCVA----DQLKKGHKVDPEHY 918
            ::|...:|.:.|:.|    .....::::..:.....||..:||..||    |..:....:..:.|
 Frog   792 LLARQVEYYSRLDCLWKRKFRKEDEEIETMENLNQLLLENVLPAHVAAYFIDDNRSNEDLYHQSY 856

  Fly   919 EQVSIYFSDIVGFTAMSAEC----TPLQVVDFLNDLYTCFDSII---GHYDVYKVETIGDAYMVV 976
            :.|.:.|:.:..|.....||    ..|:.:..||::...||.::   ....|.|::|||..||..
 Frog   857 DCVCVMFASVPEFKVFYTECDVNKEGLECLRLLNEIIADFDELLMKPKFSGVEKIKTIGSTYMAA 921

  Fly   977 SGLPLRNGD-------LHA-----AEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAG 1029
            :||....|.       .||     .|.|...:..|..::    || ..|...||:||:.|||.||
 Frog   922 TGLTATPGQENQDQEKQHALIGITVEYAMALMSKLDGIN----RH-SFNNFRLRVGINHGPVIAG 981

  Fly  1030 VVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRT 1094
            |:|.|.|:|.::|:|||.||||||:|...||..:.:..|:|:.| ||....||.|::||||:.||
 Frog   982 VIGAKKPQYDIWGNTVNVASRMESTGELGKIQVTEETCQILEGL-GYSCECRGFINVKGKGELRT 1045

  Fly  1095 YWL 1097
            |::
 Frog  1046 YFV 1048

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 11/52 (21%)
CYCc 886..1078 CDD:214485 68/214 (32%)
Guanylate_cyc 913..1099 CDD:278633 71/204 (35%)
adcy7NP_001106549.1 AC_N <21..266 CDD:318454
Guanylate_cyc 268..418 CDD:306677
DUF1053 483..591 CDD:399378
Guanylate_cyc 851..1048 CDD:306677 71/202 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.