DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Pla1a

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:278 Identity:81/278 - (29%)
Similarity:112/278 - (40%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VRSS-FYAADPTVVTI---------PRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEANDETE 100
            :||| |.|:..|.|.|         |.|        |...:||.|:..|:|:|:||.  ....|.
Mouse    73 IRSSEFNASLGTKVIIHGFRALGTKPSW--------IDKFISAVLRAADANVIAVDW--VYGSTG 127

  Fly   101 IIDSVASLVIVLHNQFDMPLDRILVVGFAE----------GAHLAGGVAAKVQQDLGRQLSQITA 155
            :..|....|:.|..:....|.::|.:|.:|          |||:.|.|....:..||    |||.
Mouse   128 VYYSAVENVVKLSLEISRFLSKLLELGVSESSIHIIGVSLGAHVGGMVGHFYKGQLG----QITG 188

  Fly   156 LDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQPGCTTD----- 211
            |||:    :.|.|:.:|...||.|||.:||:....|....:|||||:.||||.||||...     
Mouse   189 LDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGGQDQPGCPAFFHAGY 253

  Fly   212 ---SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC------------RWSTHKMGQKQEE 261
               .|.|.||..|...........::..|.|.:...|..|            |....:.|....|
Mouse   254 NYLICDHMRAVHLYISALENTCPLMAFPCASYKAFLAGDCLDCFNPFLLSCPRIGLVERGGVMIE 318

  Fly   262 EQPASGIYFLETRQSSPF 279
            ..|.....:|.|..|:|:
Mouse   319 PLPKEVKVYLLTTSSAPY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 78/271 (29%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.