DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:319 Identity:78/319 - (24%)
Similarity:137/319 - (42%) Gaps:60/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGFFLNTRRVQENAQPIE-AEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDS 85
            |.|.|.|.......|.:: ::...:..|:|..|..|...|..::.......:..:.....|.::.
  Rat    54 TRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEV 118

  Fly    86 NIISVDLSE---------ANDETEIIDSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAK 141
            |.|.||..:         ||:...:...||.::.:|...:.....::.::|.:.|||:||...::
  Rat   119 NCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEAGSR 183

  Fly   142 VQQDLGRQLSQITALDP----SSGAELDHKLSQADAEFVEVVHTNAG------GEGTWERLGHVD 196
            . ..|||    ||.|||    ..|...:.:|..:||:||:|:||:|.      |.||.:..||:|
  Rat   184 T-PGLGR----ITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLD 243

  Fly   197 YYPNGGQTQPGC-----------------TTD--SCSHERAFELLAEMWSPENDFVSARCGSVET 242
            ::|||||:.|||                 |.|  :|:|.|:::...|.....:.|.:..|.|.:.
  Rat   244 FFPNGGQSMPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASYKD 308

  Fly   243 LSASSC------------RWSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGAYFISFL 289
            ..::.|            .::....|:..:|.|.    :||.|.::..|:|..|.:|.:
  Rat   309 FESNKCFPCPDQGCPQMGHYADKFAGKSGDEPQK----FFLNTGEAKNFARWRYRVSLI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 72/300 (24%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 74/307 (24%)
PLAT_PL 356..467 CDD:238857 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.