DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and PNLIP

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:330 Identity:83/330 - (25%)
Similarity:131/330 - (39%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTI--------PRWLGNISSPEIPAVVSA 78
            |.|.|.|.....|.|.:.|:..::..|:|.....|...|        ..||.|        |...
Human    53 TRFLLYTNENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLAN--------VCKN 109

  Fly    79 RLQQQDSNIISVD--------LSEANDETEIIDS-VASLVIVLHNQFDMPLDRILVVGFAEGAHL 134
            ..:.:..|.|.||        .::|:....|:.: ||..|..|.:.|......:.|:|.:.|||.
Human   110 LFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHA 174

  Fly   135 AGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAG------GEGTW 189
            ||....:....:||    ||.|||:    .|.....:|..:||:||:|:||:..      |.|..
Human   175 AGEAGRRTNGTIGR----ITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMS 235

  Fly   190 ERLGHVDYYPNGGQTQPGC-----------------TTD--SCSHERAFELLAEMWSPENDFVSA 235
            :.:||:|::||||...|||                 |.|  :|:|.|:::...:.....:.|...
Human   236 QVVGHLDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF 300

  Fly   236 RCGSVETLSASSC----------------RW--STHKMGQKQEEEQPASGIYFLETRQSSPFSRG 282
            .|.|....:|:.|                |:  .|:.:|||          ::|:|..:|.|:|.
Human   301 PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQK----------FYLDTGDASNFARW 355

  Fly   283 AYFIS 287
            .|.:|
Human   356 RYKVS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 76/313 (24%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 79/320 (25%)
PLAT_PL 355..465 CDD:238857 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145221
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.