DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG6277

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651525.1 Gene:CG6277 / 43251 FlyBaseID:FBgn0039475 Length:341 Species:Drosophila melanogaster


Alignment Length:274 Identity:83/274 - (30%)
Similarity:133/274 - (48%) Gaps:24/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88
            |:|.|.......:.|.|..:::..|||.:|.||...|..|..:.::.....:.||.|.:.|.|:|
  Fly    70 FYLYTSSNPTKGKKITASTKSIDASSFNSAHPTRFVIHGWTQSYTASMNKDIRSAWLSRGDYNVI 134

  Fly    89 SVDLSEAND---ETEII------DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQ 144
            .||.:.|..   .|.::      ..||.::..|.:...:.|:.:.|:|.:.|||:| |.|.|   
  Fly   135 VVDWARARSVDYATSVLAVAATGKKVAKMINFLKDNHGLNLNDLYVIGHSLGAHVA-GYAGK--- 195

  Fly   145 DLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQ 205
            :...|:..|..|||:    |..:.:.:|:..||.:||.:.||.|..|..:.:|...:|||||:||
  Fly   196 NTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQ 260

  Fly   206 PGC---TTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEEEQPA 265
            |||   .|.:|||.|:....||..| |::|.:.:||..|...:..|  .:|:.:|| ........
  Fly   261 PGCGLDLTGACSHGRSTTYYAEAVS-EDNFGTMKCGDYEEAVSKECGSTYSSVRMG-ADTNAYMV 323

  Fly   266 SGIYFLETRQSSPF 279
            .|.|::.....:||
  Fly   324 EGDYYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 81/267 (30%)
CG6277NP_651525.1 Pancreat_lipase_like 68..333 CDD:238363 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.