DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG17192

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:129/283 - (45%) Gaps:31/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ETGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDS 85
            |..|:|.|::.....|.|.|:..::|.|.|.....|...|..|.|..:......:..|.|.:.|.
  Fly    62 EVSFYLYTKQNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDF 126

  Fly    86 NIISVDLSEANDETEIID-------------SVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGG 137
            |:|.|:.:    .::.:|             .|..::..:|...||.|:.:.|:|.:.|||:||.
  Fly   127 NVIVVNWA----RSQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGY 187

  Fly   138 VAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYY 198
            ...:|.|   :::..|..|||:    |....|.:||..||.:||.:.||.|.:|..:.:|...:|
  Fly   188 AGKQVGQ---KRVHTIVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFY 249

  Fly   199 PNGGQTQPGCTTD---SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQK 258
            .:||:.||||..|   :|||.|:....||..: ||.|.:.:|...:....:.|  .:|:.:|.: 
  Fly   250 VSGGRKQPGCGVDLAGTCSHARSVIYYAEAIT-ENSFGAIQCQDYQAALDNECGSSFSSVRMAE- 312

  Fly   259 QEEEQPASGIYFLETRQSSPFSR 281
            ........|.:::.....:||.:
  Fly   313 DTNAYNVEGHFYVPVNSEAPFGQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 73/271 (27%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 74/279 (27%)
Pancreat_lipase_like 62..329 CDD:238363 74/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.