DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG6295

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:277 Identity:85/277 - (30%)
Similarity:131/277 - (47%) Gaps:23/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88
            |:|.|...:.:.|.|:|...::..|.|....||..||..|..:........|..|.....|.|:|
  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFNPNHPTRFTIHGWSSSKDEFINYGVRDAWFTHGDMNMI 130

  Fly    89 SVDLSEAND---ETEII------DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQ 144
            :||...|..   .:.::      :.||:|:..:.:...:.||..:|:|.:.|||::|.....|:.
  Fly   131 AVDWGRARSVDYASSVLAVPGVGEQVATLINFMRSNHGLNLDNTMVIGHSLGAHVSGYAGKNVKN 195

  Fly   145 DLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQ 205
            .   ||..|..|||:    |....:.:||..||.:||.:.||.|..|..:.:|...:|||||::|
  Fly   196 G---QLHTIIGLDPALPLFSYDSPNKRLSSTDAYYVESIQTNGGTLGFLKPIGKGAFYPNGGKSQ 257

  Fly   206 PGCTTD---SCSHERAFELLAEMWSPENDFVSARCGSVETLSASSC--RWSTHKMGQKQEEEQPA 265
            |||..|   ||:|.|:....||..: ||:|.:.|||..|...|..|  .:|:.:||........|
  Fly   258 PGCGVDLTGSCAHSRSVIYYAESVT-ENNFPTMRCGDYEEAVAKECGSSYSSVRMGATTNAYMVA 321

  Fly   266 SGIYFLETRQSSPFSRG 282
             |.|::..|..:|:..|
  Fly   322 -GDYYVPVRSDAPYGMG 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 82/267 (31%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.