DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and sxe2

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:313 Identity:78/313 - (24%)
Similarity:128/313 - (40%) Gaps:61/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ETGFFLNTRRVQENA-------QPIEAEVEALVR---------SSFYAADPTVVTIPRWLGNISS 69
            |.|..|...|..:..       .|:..|...|:|         |.|....|..|:|..|.|...:
  Fly    55 EAGVILGRPRPSQTKLLRYDLYTPLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVT 119

  Fly    70 PEIPAVVSARLQQQDSNIISVDLSE----------ANDETEIIDSVASLVIVLHNQFDMPLDRIL 124
            ....|:..|.|.:.:.|:|.:|.|.          :.....|..:||.::..||:...:|.::|.
  Fly   120 CSNAAIKDAYLSRGNYNVIILDWSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIY 184

  Fly   125 VVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPSSGAEL----DHKLSQADAEFVEVVHTN--- 182
            ::|.:.|:|:: |:..|:.:.  .:|..|.||||:...:|    :.:|...||.:||.:||:   
  Fly   185 MIGHSAGSHIS-GLTGKLLRP--HRLGAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTL 246

  Fly   183 AGGEGTWERLGHVDYYPNGGQTQPGCTTDS-------CSHERAFELLAEMWSPENDFVSARCGSV 240
            .|...|  :|.|..::.|.|..||.|...:       |.|..|....||.......|.:.||.|.
  Fly   247 LGNPST--KLSHASFFANWGLGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSSA 309

  Fly   241 ETLSASSCRWS--------------THKMGQKQEEEQPASGIYFLETRQSSPF 279
            :::.:::|..:              ...||  .|...|..||::|.||..||:
  Fly   310 KSVLSATCNCNVGGSEKYAVNTCTGNEFMG--GEPAVPKRGIFYLSTRPQSPY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 72/303 (24%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 77/311 (25%)
Pancreat_lipase_like 72..356 CDD:238363 71/290 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.