DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and LIPC

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:295 Identity:78/295 - (26%)
Similarity:128/295 - (43%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EALVRSSFYAADPTVVTIPRW-LGNISSPEIPAVVSARLQQQDSNIISVDLSE----AND----- 97
            :.|....|.::.|.|:.|..| :..:....|..:|:| |:.|.:..::|.|.:    |:|     
Human    82 DTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAA-LKSQPAQPVNVGLVDWITLAHDHYTIA 145

  Fly    98 --ETEII-DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKV--QQDLGRQLSQITALD 157
              .|.:: ..||:|:..|.....:....:.::|::.|||::|...:.:  ...:||    ||.||
Human   146 VRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGR----ITGLD 206

  Fly   158 PS----SGAELDHKLSQADAEFVEVVHT----NAG-GEGTWERLGHVDYYPNGGQTQPGC----- 208
            .:    .|:...::||..||.||:.:||    :.| ..|..:.:||.|:|||||..||||     
Human   207 AAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLEL 271

  Fly   209 -------------TTDSCSHERAFELLAE-MWSPENDFVSARCGSVETLSASSC------RWSTH 253
                         .|..|||||:..|..: :.......::..||.:.:.|...|      |.:|.
Human   272 YRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTL 336

  Fly   254 KMGQKQEEEQPASGIYFLETRQSSPFSRGAYFISF 288
            ....:||....:..: ||.||..|||.  .|...|
Human   337 GYHVRQEPRSKSKRL-FLVTRAQSPFK--VYHYQF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 71/279 (25%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.