DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and lipca

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:284 Identity:72/284 - (25%)
Similarity:122/284 - (42%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FYAADPTVVTIPRW-LGNISSPEIPAVVSARLQQQDSNIISVDLSE-----------ANDETEII 102
            |.::.|..:.|..| :..:....|..:.|| |:..:.| |:|.:::           |...|.|:
Zfish    74 FNSSLPLAIIIHGWSVDGMMEKWISRLASA-LKSSEGN-INVLIADWLTLAHQHYPIAAQNTRIV 136

  Fly   103 -DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS----SGA 162
             ..:|.|:..|.:....||.::.::|::.|||::|...:.:... ||.|.:||.|||:    .|.
Zfish   137 GQDIAHLLSWLEDFKQFPLGKVHLIGYSLGAHISGFAGSNLAMS-GRTLGRITGLDPAGPMFEGM 200

  Fly   163 ELDHKLSQADAEFVEVVHTNAGGEGTWERLG----------HVDYYPNGGQTQPGC--------- 208
            ....:||..||:||:.:||     .|.:|:|          |.|:|||||..||||         
Zfish   201 SHTDRLSPEDAKFVDAIHT-----FTLQRMGLSVGIKQPVAHFDFYPNGGSFQPGCQLHMQNIYA 260

  Fly   209 -----------TTDSCSHERAFELLAE-MWSPENDFVSARCGSVETLSASSC------RWSTHKM 255
                       .|..|:||||..|..: :.:.:...::.:|.........:|      |.:|...
Zfish   261 HLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDCRKNRCNTLGY 325

  Fly   256 GQKQEEEQPASGIYFLETRQSSPF 279
            ..|:.....:..: ||:||...|:
Zfish   326 DIKKVRTGKSKRL-FLKTRSHMPY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 69/277 (25%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 72/284 (25%)
Pancreat_lipase_like 54..344 CDD:238363 70/278 (25%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.