DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG10163

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:227 Identity:61/227 - (26%)
Similarity:98/227 - (43%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QQDSNIISVDLSEANDETEIIDSVASLVIVLHNQFDMPLDR-----------ILVVGFAEGAHLA 135
            ::|.|:|.||.  |.|..::..:|...:.| :..|...|.|           |.:.|.:.||::|
  Fly   142 RRDLNVIVVDF--AKDVAQLYYAVRHHLSV-NGYFVYKLLRALKDAGIAVQDITLAGHSVGANIA 203

  Fly   136 GGVAAKVQQDLGRQLSQITALDPSSGAE-LDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYP 199
            ...|....::..:.:.|:.|:||::... .|..:.|:.|..|.|:|......|....|||:|.||
  Fly   204 ALGAQLFAKENKQLVGQLLAIDPATMCRTTDILVKQSVALRVVVLHGEGDVFGVRVPLGHIDIYP 268

  Fly   200 NG------GQTQPGCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCR-WSTHKMGQ 257
            ||      .:.||||.:..|||...|.|          |:.|....| .:.|:.|. |:..:.|.
  Fly   269 NGIGYFPRRKLQPGCESKICSHMYPFIL----------FMEALIEGV-MIPATKCESWAKFRQGD 322

  Fly   258 KQEEE-------QPAS--GIYFLETRQSSPFS 280
            ...:.       .||:  |:||..|:.:.||:
  Fly   323 CNFQNTINIGLIYPANAKGLYFCMTQPNPPFT 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 58/219 (26%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 59/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.