DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG13562

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:290 Identity:54/290 - (18%)
Similarity:104/290 - (35%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNII 88
            |:.|..:..|.:...:|  ..|..|.....|...:.:..|:.:.|.....:::......:...:|
  Fly    65 FYKNNTKTMETSAYDDA--YDLSGSGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVI 127

  Fly    89 SVDLS----------EANDETEIIDSVASLVIVLHNQ-FDMPLDRILVVGFAEGAHLAGGVAAKV 142
            .:|.|          ..|.:| :..:::|:::.|..| ||.  .|..:.||:.|..||..|    
  Fly   128 CIDYSVVASSSYMRLYTNFDT-LTGAISSIILTLFRQGFDP--KRGYMFGFSFGGQLASAV---- 185

  Fly   143 QQDLGRQLSQ---ITALDPSSGA-------ELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDY 197
                ||.|..   |.::|....|       .:||  |:| .:.|:..|::. .:||:....|.:.
  Fly   186 ----GRSLRPHHIIESIDTCDMAGPGFDPIAVDH--SKA-GKHVQCFHSSR-DKGTFVYSCHRNI 242

  Fly   198 YPNG-GQTQP-----------GCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRW 250
            .... |..||           |...|...:...:...|..::|...|...:...:.         
  Fly   243 MLGSCGLKQPSVASQLHLGSHGLCVDIYINTFDYPFYAVNYTPPECFTWQKTAKIP--------- 298

  Fly   251 STHKMGQKQEEEQPASGIYFLETRQSSPFS 280
            ..:.:|.::..:...:|..|:.|....|::
  Fly   299 DGYTVGYEENFDSQVTGQIFVPTSLHYPYN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 52/282 (18%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 32/155 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.