DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG6472

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:136/294 - (46%) Gaps:42/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEA-LVRSSFYAADPTVVTIPRWLGNI-----SSPEIPAVVSARLQQ 82
            |.|.|.|.:.:||.:....:| |.:|:|....|..:.:..:..:.     ||.|:.   .|.|::
  Fly    46 FMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSSQELK---DAFLRR 107

  Fly    83 QDSNIISVDLSEANDETEIIDSVASLVI-------VLHNQFD--MPLDRILVVGFAEGAHLAGGV 138
            .:.|:|.:|.|.........::|.:|.:       .|....|  .|...|.::||:.||.:| |.
  Fly   108 GNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKGYPAKYIHLIGFSLGAEVA-GF 171

  Fly   139 AAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYP 199
            |.|..|:.|.:|.:||||||:    .|...:.:||.:||.||:|:||:.|..|....:||.|:||
  Fly   172 AGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYP 236

  Fly   200 NGGQ-TQPGCTTDS-----------CSHERAFELLAEMWSPENDFVSARCGSVETLSASSCR--- 249
            |||: .||||...:           |||:||:|...|..:....|.:.||...:....  ||   
  Fly   237 NGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMFGI--CREPG 299

  Fly   250 WSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGA 283
            .....||...:..  ..|.::|:|..:.||.|.:
  Fly   300 GGPAFMGMGADPR--IRGKFYLDTNDAKPFGRNS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 83/283 (29%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 84/284 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.