DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG6675

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:278 Identity:75/278 - (26%)
Similarity:130/278 - (46%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEALVR-SSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNI 87
            |:|..|...|..:.::..:|...| ..|.|:.||.:.|..|:..........|.:|.|::.:.|:
  Fly   120 FYLFKREFPECGREVDFSIERKWRHCGFNASLPTRLMIHGWMSQSRGSFNRDVKNAYLKKGEYNV 184

  Fly    88 ISVD--LSEAN----DETEIIDS----VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKV 142
            |.||  .|.||    ...::|::    :|..:..|:.||....|.:.::|.:.||.:||....::
  Fly   185 IVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSLGAQIAGSAGKRL 249

  Fly   143 QQDLGRQLSQITALDPSSGAELDH-----KLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGG 202
            :.   .:::.|.|||| :|.:..|     ::..:||::||.:||:| ..|.....|...:|||.|
  Fly   250 KP---VKVNTIFALDP-AGPKFRHRGTEFRIDPSDAKYVESMHTSA-NFGFRRPTGSATFYPNYG 309

  Fly   203 QTQPGCTTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPA-- 265
            ..|..|....|||.|::::.||..:....|....|  :.......|.:|..:..|...|  |:  
  Fly   310 AYQHSCYYLGCSHIRSYQMFAESINSPLGFWGTPC--IRDNGRWQCDYSQRQSIQMAGE--PSIH 370

  Fly   266 -SGIYFLETRQSSPFSRG 282
             .||::::|..|.||:.|
  Fly   371 KEGIFYVKTSSSDPFALG 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 70/268 (26%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.