DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG6431

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:212 Identity:56/212 - (26%)
Similarity:84/212 - (39%) Gaps:24/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEAND---------ETE 100
            |.:..|.....||..|..:.|......:..:..|.| .:|.|:|:||......         .|.
  Fly    85 LYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYL-SRDFNVITVDWRPLTRYPCYLHSLINTR 148

  Fly   101 IIDSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPSSG---- 161
            :.....:.:......:....:||..||.:.|||:.|    .:...|.|:..:|..|||:..    
  Fly   149 LTAQCTAQIYAFLTHYGAVRERITCVGHSLGAHICG----MISNHLTRKQYRIIGLDPARPLIER 209

  Fly   162 -AELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQPGC-----TTDSCSHERAFE 220
             .....:||..||..::|:|||||..|..:..||::|..|||:.||.|     ....|||..:..
  Fly   210 MKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQPFCKGNPIRKSRCSHFLSIC 274

  Fly   221 LLAEMWSPENDFVSARC 237
            .||......|.|:...|
  Fly   275 YLATATFKHNKFMGVPC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 56/212 (26%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 56/212 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.