DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG14034

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:294 Identity:87/294 - (29%)
Similarity:133/294 - (45%) Gaps:47/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNIS-SPEI---PAVVSARLQQQD 84
            |:|.|:   ||.:..:..|..|.|..||...|..|.|..:.|:.. ||..   |..::     ||
  Fly    40 FWLYTK---ENQEGTKLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFLT-----QD 96

  Fly    85 SNIISVDLSEANDE---TEIIDS-------VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVA 139
            .|:||:|..:...|   ||.:.:       .|.|:.||.....:.::.:.::|...|||:||.:.
  Fly    97 YNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIG 161

  Fly   140 AKVQQDLGRQLSQITALDPSSGAELDH----KLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPN 200
            ..:.:   .:|..||||||:....:..    ||...||:||:||||:....|..:.:||||:|.|
  Fly   162 QFLPE---HKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLN 223

  Fly   201 GGQTQPGC------TTDSCSHERAFELLAEMWSPENDFVSARCGSVETLSASSCRWSTHKMGQKQ 259
            .|.:||.|      .|..|.|.||.:..||..|..:.|....|.:.::.:...|      :..|.
  Fly   224 MGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC------IPDKN 282

  Fly   260 EE------EQPASGIYFLETRQSSPFSRGAYFIS 287
            .|      :..|.|.|||:|....|:::|..|.|
  Fly   283 IELMGFHVDPKARGRYFLDTNNGPPYAKGENFTS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 82/279 (29%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 82/279 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.