DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG4267

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:274 Identity:71/274 - (25%)
Similarity:120/274 - (43%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQ------------QQDSNIISVDLS 93
            :||.|..|.|.|...|.:.|..|:.......|..|.:|.|.            .:|.|:|..|.|
  Fly    92 DVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWS 156

  Fly    94 EANDET---EIIDSV-------ASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGR 148
            :.:...   |:..:|       |.||..|:.:.:|..|.:.|:|.:.||.:||...   :|.:..
  Fly   157 KTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAG---KQIMPY 218

  Fly   149 QLSQITALDPSSGAEL-----DHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQPGC 208
            :.:.|.|||| :|.:.     ::::..:||.:||.:.|:. ..|..:.:||..:|||.|:.|..|
  Fly   219 RFNTIYALDP-AGPQFREKSDEYRIDASDASYVESIQTSV-SFGFEQPVGHATFYPNYGKNQKKC 281

  Fly   209 TTDSCSHERAFELLAEMWSPENDFVSARC-----GSVETLSASSCRWSTHKMGQKQEEEQPASGI 268
            ....|||:|:.:...|..:....|...||     |:...|.:.    ...:||  .|...|.:|.
  Fly   282 YVYGCSHKRSHDYFIESLTSPAGFWGPRCERHDDGTWLLLMSD----GEFRMG--GEPSIPKNGT 340

  Fly   269 YFLETRQSSPFSRG 282
            ::::|....|::.|
  Fly   341 FYVKTYSKPPYAMG 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 68/264 (26%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 69/269 (26%)
Pancreat_lipase_like 71..347 CDD:238363 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.