DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and pla1a

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:229 Identity:65/229 - (28%)
Similarity:96/229 - (41%) Gaps:42/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FYAADPTVVTI---------PRWLGNISSPEIPAVVSARLQQQDSNIISVD----LSEA-NDETE 100
            |.::.||.|.:         |.|:..::        .|.|:::|.|::.||    .|.| |...|
Zfish    81 FNSSLPTKVIVHGYRALGSKPSWVSGLA--------QALLREEDVNVLVVDWVYGASFAYNLVVE 137

  Fly   101 IIDSVASLVIVLHNQ---FDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS--- 159
            ....||..:.||.||   :...|:....:|.:.|||::|.|.......|||    ||.|||:   
Zfish   138 NYKEVAVQISVLINQLTKYGSTLESFHFIGVSLGAHVSGFVGTLFHGKLGR----ITGLDPAGPM 198

  Fly   160 -SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQTQPGCTTDS---------CS 214
             ..|:...:|..:||.|||.:||::...|....:||||::.|||..|.||....         |.
Zfish   199 FKSADPFDRLDSSDALFVEAIHTDSDYFGISIPVGHVDFFLNGGMDQAGCARSRFASMYGYVICD 263

  Fly   215 HERAFELLAEMWSPENDFVSARCGSVETLSASSC 248
            |.||..:.....:.....:...|...|...|..|
Zfish   264 HMRALHVYMSALNGSCPLIGFPCSGYEEFLAGKC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 65/229 (28%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 65/229 (28%)
Pancreat_lipase_like 48..336 CDD:238363 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.