DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG5162

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:123/260 - (47%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EALVRSSFYAADPTVVTIPR-WLGNISSPEIPAVVSARLQ-QQDSNIISVDLS---------EAN 96
            |::.:|..:.....||.:.. |...::..:...|.|.... :.|.|.::||.:         .|.
  Fly   119 ESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFSKAYNCRGDVNFVAVDAARFVDTLYTWSAF 183

  Fly    97 DETEIIDSVASLVIVLHNQFDM-PLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS- 159
            :..||.:::|..::.|   .|: |::.|.::|.:.|||:.|.....:|....:.:.:||.|||: 
  Fly   184 NTEEIGENIALGLVKL---LDLVPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAK 245

  Fly   160 ---SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNG-GQTQPGCTTDSCSHERAFE 220
               :..|....|.:.||.||:|:|:|.|..|..:.:|.||:||.| .....||.:.:|:|.|::|
  Fly   246 PCFNEGEALSGLMRGDAHFVDVIHSNPGVLGKRDPVGDVDFYPGGMSPLAAGCFSVTCAHARSWE 310

  Fly   221 LLAEMWSP--ENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGA 283
            ..||...|  |.:|::.||.|:..|....|......||  ....|...|.||||...|:||...|
  Fly   311 YFAETVFPGNERNFMATRCNSISKLRDFRCPGDEVPMG--YAVPQNIKGNYFLEVSASAPFGMHA 373

  Fly   284  283
              Fly   374  373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 71/249 (29%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 72/254 (28%)
Pancreat_lipase_like 99..365 CDD:238363 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446034
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.