DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and CG18258

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:279 Identity:80/279 - (28%)
Similarity:133/279 - (47%) Gaps:27/279 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVDLSEAN 96
            |..:.|:....:....:.||...|||:.|..|..:|::.....|..|.|.:.|:|::.:|.:...
  Fly   183 QNTSIPLTQAEQLWNTTGFYQDRPTVLFITGWTTSINNSNSGPVAKAYLCRNDTNVLILDAANFI 247

  Fly    97 D--------ETEII-DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQ-LS 151
            |        .||:| |.:|..::.|:..:  ...:..:||.:.||.:||......::..|.| |.
  Fly   248 DTLYTWSALNTEVIGDYLAKALLRLNTSY--VTKQFHLVGHSLGAQIAGSAGRNYRRLSGGQILK 310

  Fly   152 QITALDPSS-----GAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGG-QTQPGCTT 210
            :||.|||::     |.||: .|...||.||:::|||.|..||.:|.|..|::..|. ..:|||.:
  Fly   311 RITGLDPANPCFYDGNELE-GLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQGRIPFKPGCES 374

  Fly   211 ---DSCSHERAFELLAEMWSPE--NDFVSARCGSV-ETLSASSCRWSTHKMGQKQEEEQPASGIY 269
               .||||:||.:...|...|.  |||::.||... |.|..:.|:.:...||...:...  .|::
  Fly   375 LDPISCSHQRAVDYWTETVYPSNGNDFLAKRCKRYSELLLGNYCKNTNTVMGYAAKATD--LGLF 437

  Fly   270 FLETRQSSPFSRGAYFISF 288
            ::......|:.:.|...|:
  Fly   438 YVGANPEEPYGQNANLQSY 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 77/263 (29%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.