DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Yp2

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:220 Identity:63/220 - (28%)
Similarity:104/220 - (47%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QQQDS---NIISVDLSEANDETE---------IIDSVASLVIVLHNQFDMPLDRILVVGFAEGAH 133
            :|.|:   ::|.:.|..|.::.|         :.:.:.:.::.|.|..::|.:.|.::|....||
  Fly   196 EQDDTKTGDLIVIQLGNAIEDFEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAH 260

  Fly   134 LAGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGH 194
            :||....:..:..|.:|.:||||||:    ...|....|::.||:||:.:||:|.|.||.:||.:
  Fly   261 VAGVAGRQFTRQTGHKLRRITALDPTKIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLAN 325

  Fly   195 VDYYPNGGQT-QPGCTTDSCSHERAFELLAEMWSP--ENDFVSARCGSVETLSASSCRWSTHKMG 256
            ||::|||..| .||......:..||....||...|  |.:|.|....|.:....:........||
  Fly   326 VDFFPNGPSTGVPGADNVVEATMRATRYFAESVRPGNERNFPSVAASSYQEYKQNKGYGKRGYMG 390

  Fly   257 QKQEEEQPASGIYFLETRQSSPFSR 281
            ...:.:  ..|.|.|:....|||.|
  Fly   391 IATDFD--LQGDYILQVNSKSPFGR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 59/211 (28%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 60/216 (28%)
Abhydrolase <221..407 CDD:304388 53/187 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438318
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.