DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and lpl

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:335 Identity:83/335 - (24%)
Similarity:155/335 - (46%) Gaps:80/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TLTIAAVYG------------ETGFFLNTRRVQEN--AQPIEAEVEALVRSSFYAADPTVVTIPR 62
            ::|::.:.|            |:.|...|....|:  ...:..:.:::...:|.....|.:.|..
Zfish    36 SITLSDIIGNATEWMMDFTDIESKFSFRTLEEPEDDLCYIVPGQPQSIKDCNFNTETKTFIVIHG 100

  Fly    63 W-LGNISSPEIPAVVSARLQQQDS-NIISVD-LSEANDE-------TEII-DSVASLVIVLHNQF 116
            | :..:....:|.:|:|..:::.| |:|.|| ||.|...       |::: ..||..|..|..:.
Zfish   101 WTVTGMFESWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTSASYTKLVGKDVAKFVNWLQAEI 165

  Fly   117 DMPLDRILVVGFAEGAHLAG--GVAAKVQQDLGRQLSQITALDPSSGAELDH-----KLSQADAE 174
            |.|.:::.::|::.|||:||  |:..|      .::::||.:|| :|...::     .||..||.
Zfish   166 DYPWEKLHLLGYSLGAHVAGIAGLLTK------HKVNRITGMDP-AGPTFEYADSLSTLSPDDAN 223

  Fly   175 FVEVVHTNAGGE-----GTWERLGHVDYYPNGGQTQPGC----------TTD--------SCSHE 216
            ||:|:|||..|.     |....:||:|.|||||..||||          ||.        .||||
Zfish   224 FVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKCSHE 288

  Fly   217 RAFELLAE-MWSPENDFVSARCGSVETLSAS---SCR--------WSTHKMGQKQEEEQPASGIY 269
            |:..|..: :.:.:::.::.||.|.::.:..   |||        ::.:|:..::..:.      
Zfish   289 RSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVNKIRTRRSSKM------ 347

  Fly   270 FLETRQSSPF 279
            :::||:..|:
Zfish   348 YMKTREMMPY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 77/304 (25%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 81/319 (25%)
Pancreat_lipase_like 56..353 CDD:238363 79/309 (26%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.