DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Lipg

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:261 Identity:68/261 - (26%)
Similarity:116/261 - (44%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WLGNISSPEIPAVVSARLQQQDSNIISVD--------LSEANDETEIID-SVASLVIVLHNQFDM 118
            ||..:       |.:.:.:::::|::.||        ..:|...|.::. .||.::..|..:.:.
  Rat   103 WLHKL-------VSALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVVGRRVAGMLNWLQEKGEF 160

  Fly   119 PLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVV 179
            .|..:.::|::.|||:||.....|:..:||    ||.|||:    .|.:::.:||..||:||:|:
  Rat   161 SLGDVHLIGYSLGAHVAGYAGNFVKGTVGR----ITGLDPAGPMFEGVDINRRLSPDDADFVDVL 221

  Fly   180 HT---NAG-GEGTWERLGHVDYYPNGGQTQPGCTTD---------------SCSHERAFELLAE- 224
            ||   :.| ..|....:||:|.|||||..||||..:               .|.||||..|..: 
  Rat   222 HTYTLSFGLSIGIRMPVGHIDIYPNGGDFQPGCGFNDVMGSFAYGTISEMVKCEHERAVHLFVDS 286

  Fly   225 -----------MWSPENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPASGIYFLETRQSSP 278
                       ..:..|.|....|.|......::..::..||.:|:..:.      :|:||...|
  Rat   287 LVNQDKPSFAFQCTDPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKM------YLKTRAGMP 345

  Fly   279 F 279
            |
  Rat   346 F 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 64/254 (25%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 65/255 (25%)
lipo_lipase 53..488 CDD:132274 68/261 (26%)
Heparin-binding. /evidence=ECO:0000250 327..339 3/17 (18%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.