DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Pnlip

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:316 Identity:76/316 - (24%)
Similarity:131/316 - (41%) Gaps:58/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGFFLNTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSN 86
            |.|.|.|...|:|.|.|.::..::..|:|.....|.:.|..::.......:..:.....:.:..|
  Rat    53 TRFLLYTNENQDNYQKITSDASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKVESVN 117

  Fly    87 IISVD--------LSEANDETEIIDS-VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKV 142
            .|.||        .::|.....::.: ||.||.||.:......|.:.::|.:.|:|:||....:.
  Rat   118 CICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAGEAGKRT 182

  Fly   143 QQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAG------GEGTWERLGHVDY 197
            ...:||    ||.||.:    .|...:.:|...||:||:.:||:|.      |.|..:.:||:|:
  Rat   183 FGAIGR----ITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGHLDF 243

  Fly   198 YPNGGQTQPGC-----------------TTD--SCSHERAFELLAEMWSPENDFVSARCGSVETL 243
            :||||...|||                 |.|  :|:|.|:::...:.......|....|.|....
  Rat   244 FPNGGMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPTGFSGFSCSSYNVF 308

  Fly   244 SASSC------------RWSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGAYFIS 287
            ||:.|            .::....|:.:|..|.    ::|.|...|.|:|..|.::
  Rat   309 SANKCFPCGSEGCPQMGHYADKYPGKTKELYQK----FYLNTGDKSNFARWRYQVT 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 70/299 (23%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 73/306 (24%)
PLAT_PL 355..465 CDD:238857 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338913
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.