DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Lpl

DIOPT Version :10

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:340 Identity:97/340 - (28%)
Similarity:155/340 - (45%) Gaps:75/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VQLALFL-TLT-----IAAVYG-------ETGFFLNTRR--VQENAQPIEAEVEALVRSSFYAAD 54
            |.|.::| :||     :||..|       |:.|.|.|..  .::....|....:::....|..:.
  Rat     9 VALGVWLQSLTAFRGGVAAADGGRDFSDIESKFALRTPEDTAEDTCHLIPGLADSVSNCHFNHSS 73

  Fly    55 PTVVTIPRW-LGNISSPEIPAVVSARLQQQ-DSNIISVD-LSEANDE-------TEII-DSVASL 108
            .|.|.|..| :..:....:|.:|:|..::: |||:|.|| |..|...       |::: :.||..
  Rat    74 KTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARF 138

  Fly   109 VIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPSSG----AELDHKLS 169
            :..|..:|:.|||.:.::|::.||| |.|||..:   ..:::::||.|||:..    ||...:||
  Rat   139 INWLEEEFNYPLDNVHLLGYSLGAH-AAGVAGSL---TNKKVNRITGLDPAGPNFEYAEAPSRLS 199

  Fly   170 QADAEFVEVVHTNAGGE-----GTWERLGHVDYYPNGGQTQPGCTTD------------------ 211
            ..||:||:|:||...|.     |..:.:||||.|||||..||||...                  
  Rat   200 PDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAEKGLGDVDQLV 264

  Fly   212 SCSHERAFELLAE-MWSPENDFVSARCGSVETLSAS---SCR--------WSTHKMGQKQEEEQP 264
            .|||||:..|..: :.:.||...:.||.|.|.....   |||        :..:|:..|:..:. 
  Rat   265 KCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLSCRKNRCNNVGYEINKVRAKRSSKM- 328

  Fly   265 ASGIYFLETRQSSPF 279
                 :|:||...|:
  Rat   329 -----YLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 alpha/beta hydrolases 24..274 CDD:473884 85/301 (28%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53 4/20 (20%)
lipo_lipase 33..472 CDD:132274 89/316 (28%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 1/22 (5%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.