DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Lipc

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:310 Identity:78/310 - (25%)
Similarity:128/310 - (41%) Gaps:71/310 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EALVRSSFYAADPTVVTIPRWLGNISSP--------------------EIPAVVSARLQQQDSNI 87
            |.|....|.::.|.|:.|..|.|:.|:.                    :|...:.:| |.|..|:
  Rat    71 ETLQECGFNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKSR-QSQPVNV 134

  Fly    88 ISVD--------LSEANDETEII-DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQ 143
            ..||        .:.|...|.:: ..||:|::.|.........::.::|::.|||::|...:   
  Rat   135 GLVDWISLAYQHYAIAVRNTRVVGQEVAALLLWLEESMKFSRSKVHLIGYSLGAHVSGFAGS--- 196

  Fly   144 QDLG--RQLSQITALDPS----SGAELDHKLSQADAEFVEVVHT----NAG-GEGTWERLGHVDY 197
             .:|  |::.:||.|||:    .|...:.:||..||.||:.:||    :.| ..|..:.:.|.|:
  Rat   197 -SMGGKRKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDF 260

  Fly   198 YPNGGQTQPGC------------------TTDSCSHERAFELLAEMWSPEN-DFVSARCGSVETL 243
            |||||..||||                  .|..|:|||:..|..:.....| .....:|.::::.
  Rat   261 YPNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSNLQNTGFQCSNMDSF 325

  Fly   244 SASSC----RWSTHKMGQKQEEEQP-ASGIYFLETRQSSPFSRGAYFISF 288
            |...|    :...:.:|.....::| .|...||.||..|||.  .|...|
  Rat   326 SQGLCLNCKKGRCNSLGYDIRRDRPRKSKTLFLITRAQSPFK--VYHYQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 71/294 (24%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 74/299 (25%)
Pancreat_lipase_like 47..362 CDD:238363 72/295 (24%)
PLAT_LPL 369..504 CDD:238856 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.