DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and LIPH

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:326 Identity:90/326 - (27%)
Similarity:140/326 - (42%) Gaps:73/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAVYGETG----FFLNTRRVQENAQPIEA----EVEALVRSSF--YAADPTVVTIPRWLGNISSP 70
            :||.| ||    ..|.||:....||.|.:    .:....:::|  :...|| .:.|.|:.::   
Human    32 SAVVG-TGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKTTFIVHGFRPT-GSPPVWMDDL--- 91

  Fly    71 EIPAVVSARLQQQDSNIISVDLSEANDETEIIDSVAS-----LVIVLHNQFDM------PLDRIL 124
                 |...|..:|.|::.||.:..  .|.:|.:.||     :.:||....|.      .||.|.
Human    92 -----VKGLLSVEDMNVVVVDWNRG--ATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLDDIY 149

  Fly   125 VVGFAEGAHLAGGVAAKVQQDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHTNAGG 185
            ::|.:.|||::|.|.......|||    ||.|||:    :|.....:|..:||:||:|:|::...
Human   150 MIGVSLGAHISGFVGEMYDGWLGR----ITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDA 210

  Fly   186 EGTWERLGHVDYYPNGGQTQPGCTTD--------SCSHERAFEL-----------LAEMWSPEND 231
            .|..|.||::|:|||||..||||...        .|.|:|:..|           .|.......|
Human   211 LGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQD 275

  Fly   232 FVSARCGSVETLSASSC--------RWSTHKMGQKQEEEQPASGIYFLETRQSSPFSRGAYFISF 288
            :.:.:|.|..|....||        .|..|..|    ::.|.:..:| :|.:.|||....||:..
Human   276 YRNGKCVSCGTSQKESCPLLGYYADNWKDHLRG----KDPPMTKAFF-DTAEESPFCMYHYFVDI 335

  Fly   289 L 289
            :
Human   336 I 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 79/297 (27%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 74/278 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.