DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10116 and Lipc

DIOPT Version :9

Sequence 1:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:308 Identity:76/308 - (24%)
Similarity:129/308 - (41%) Gaps:67/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EALVRSSFYAADPTVVTIPRWLGNISSPE-----------------IPAVVSARLQQQDSNIISV 90
            |.|....|.::.|.::.|..|.|:.|:..                 |..:||| |:.:.|..::|
Mouse    71 ETLQECGFNSSQPLIMIIHGWSGSESATVGKDSDSDYQVDGLLENWIWKIVSA-LKSRQSQPVNV 134

  Fly    91 DLSE-----------ANDETEII-DSVASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQ 143
            .|.:           |...|.|: ..||:|::.|.........::.::|::.|||::|...:.: 
Mouse   135 GLVDWISLAYQHYTIAVQNTRIVGQDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSM- 198

  Fly   144 QDLGRQLSQITALDPS----SGAELDHKLSQADAEFVEVVHT----NAG-GEGTWERLGHVDYYP 199
             |...::.:||.|||:    .|...:.:||..||.||:.:||    :.| ..|..:.:.|.|:||
Mouse   199 -DGKNKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYP 262

  Fly   200 NGGQTQPGC------------------TTDSCSHERAFELLAE-MWSPENDFVSARCGSVETLSA 245
            |||..||||                  .|..|:|||:..|..: :...:...:..:|..:.:.|.
Mouse   263 NGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQ 327

  Fly   246 SSC----RWSTHKMGQK-QEEEQPASGIYFLETRQSSPFSRGAYFISF 288
            ..|    :...:.:|.. :::....|...||.||..|||.  .|...|
Mouse   328 GLCLSCKKGRCNTLGYDIRKDRSGKSKRLFLITRAQSPFK--VYHYQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 69/292 (24%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 72/297 (24%)
PLAT_LPL 369..504 CDD:238856 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.